Anti THAP3 pAb (ATL-HPA067114)

Atlas Antibodies

Catalog No.:
ATL-HPA067114-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: THAP domain containing, apoptosis associated protein 3
Gene Name: THAP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039759: 61%, ENSRNOG00000026840: 64%
Entrez Gene ID: 90326
Uniprot ID: Q8WTV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PNKQPSDHSYALLDLDSLKKKLFLTLKENEKLRKRLQAQRLVMRRMSSRLRACKGHQGLQARLGPEQQS
Gene Sequence PNKQPSDHSYALLDLDSLKKKLFLTLKENEKLRKRLQAQRLVMRRMSSRLRACKGHQGLQARLGPEQQS
Gene ID - Mouse ENSMUSG00000039759
Gene ID - Rat ENSRNOG00000026840
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THAP3 pAb (ATL-HPA067114)
Datasheet Anti THAP3 pAb (ATL-HPA067114) Datasheet (External Link)
Vendor Page Anti THAP3 pAb (ATL-HPA067114) at Atlas Antibodies

Documents & Links for Anti THAP3 pAb (ATL-HPA067114)
Datasheet Anti THAP3 pAb (ATL-HPA067114) Datasheet (External Link)
Vendor Page Anti THAP3 pAb (ATL-HPA067114)