Anti THAP3 pAb (ATL-HPA067114)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067114-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: THAP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039759: 61%, ENSRNOG00000026840: 64%
Entrez Gene ID: 90326
Uniprot ID: Q8WTV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PNKQPSDHSYALLDLDSLKKKLFLTLKENEKLRKRLQAQRLVMRRMSSRLRACKGHQGLQARLGPEQQS |
| Gene Sequence | PNKQPSDHSYALLDLDSLKKKLFLTLKENEKLRKRLQAQRLVMRRMSSRLRACKGHQGLQARLGPEQQS |
| Gene ID - Mouse | ENSMUSG00000039759 |
| Gene ID - Rat | ENSRNOG00000026840 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti THAP3 pAb (ATL-HPA067114) | |
| Datasheet | Anti THAP3 pAb (ATL-HPA067114) Datasheet (External Link) |
| Vendor Page | Anti THAP3 pAb (ATL-HPA067114) at Atlas Antibodies |
| Documents & Links for Anti THAP3 pAb (ATL-HPA067114) | |
| Datasheet | Anti THAP3 pAb (ATL-HPA067114) Datasheet (External Link) |
| Vendor Page | Anti THAP3 pAb (ATL-HPA067114) |