Anti THAP10 pAb (ATL-HPA073220)

Atlas Antibodies

Catalog No.:
ATL-HPA073220-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: THAP domain containing 10
Gene Name: THAP10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039759: 33%, ENSRNOG00000026840: 33%
Entrez Gene ID: 56906
Uniprot ID: Q9P2Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CRADWYGGNDRSVICSDHFAPACFDVSSVIQKNLRFSQRLRLVAGAVPTLHRVPAPAPKRGEEGDQAGRLDTRGELQAAR
Gene Sequence CRADWYGGNDRSVICSDHFAPACFDVSSVIQKNLRFSQRLRLVAGAVPTLHRVPAPAPKRGEEGDQAGRLDTRGELQAAR
Gene ID - Mouse ENSMUSG00000039759
Gene ID - Rat ENSRNOG00000026840
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THAP10 pAb (ATL-HPA073220)
Datasheet Anti THAP10 pAb (ATL-HPA073220) Datasheet (External Link)
Vendor Page Anti THAP10 pAb (ATL-HPA073220) at Atlas Antibodies

Documents & Links for Anti THAP10 pAb (ATL-HPA073220)
Datasheet Anti THAP10 pAb (ATL-HPA073220) Datasheet (External Link)
Vendor Page Anti THAP10 pAb (ATL-HPA073220)