Anti THAP1 pAb (ATL-HPA071310)

Atlas Antibodies

Catalog No.:
ATL-HPA071310-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: THAP domain containing, apoptosis associated protein 1
Gene Name: THAP1
Alternative Gene Name: 4833431A01Rik, DYT6, FLJ10477
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037214: 95%, ENSRNOG00000056956: 94%
Entrez Gene ID: 55145
Uniprot ID: Q9NVV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYF
Gene Sequence VNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYF
Gene ID - Mouse ENSMUSG00000037214
Gene ID - Rat ENSRNOG00000056956
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THAP1 pAb (ATL-HPA071310)
Datasheet Anti THAP1 pAb (ATL-HPA071310) Datasheet (External Link)
Vendor Page Anti THAP1 pAb (ATL-HPA071310) at Atlas Antibodies

Documents & Links for Anti THAP1 pAb (ATL-HPA071310)
Datasheet Anti THAP1 pAb (ATL-HPA071310) Datasheet (External Link)
Vendor Page Anti THAP1 pAb (ATL-HPA071310)