Anti THAP1 pAb (ATL-HPA071310)

Atlas Antibodies

Catalog No.: ATL-HPA071310-25

Protein Description: THAP domain containing, apoptosis associated protein 1
Gene Name: THAP1
Alternative Gene Name: 4833431A01Rik, DYT6, FLJ10477
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037214: 95%, ENSRNOG00000056956: 94%
Entrez Gene ID: 55145
Uniprot ID: Q9NVV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYF
• Gene Sequence: VNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYF
• Gene ID - Mouse: ENSMUSG00000037214
• Gene ID - Rat: ENSRNOG00000056956
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.