Anti TH pAb (ATL-HPA061003 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA061003-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: tyrosine hydroxylase
Gene Name: TH
Alternative Gene Name: DYT5b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000214: 88%, ENSRNOG00000020410: 88%
Entrez Gene ID: 7054
Uniprot ID: P07101
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
Gene Sequence SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
Gene ID - Mouse ENSMUSG00000000214
Gene ID - Rat ENSRNOG00000020410
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TH pAb (ATL-HPA061003 w/enhanced validation)
Datasheet Anti TH pAb (ATL-HPA061003 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TH pAb (ATL-HPA061003 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TH pAb (ATL-HPA061003 w/enhanced validation)
Datasheet Anti TH pAb (ATL-HPA061003 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TH pAb (ATL-HPA061003 w/enhanced validation)
Citations for Anti TH pAb (ATL-HPA061003 w/enhanced validation) – 2 Found
Mastitskaya, Svetlana; Turovsky, Egor; Marina, Nephtali; Theparambil, Shefeeq M; Hadjihambi, Anna; Kasparov, Sergey; Teschemacher, Anja G; Ramage, Andrew G; Gourine, Alexander V; Hosford, Patrick S. Astrocytes Modulate Baroreflex Sensitivity at the Level of the Nucleus of the Solitary Tract. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2020;40(15):3052-3062.  PubMed
Yang, Weiwei; Hao, Wenwen; Meng, Zhuo; Ding, Shiyan; Li, Xiaodi; Zhang, Tao; Huang, Weixiao; Xu, Lian; Zhang, Yu; Yang, Jian; Gu, Xiaosong. Molecular Regulatory Mechanism and Toxicology of Neurodegenerative Processes in MPTP/Probenecid-Induced Progressive Parkinson's Disease Mice Model Revealed by Transcriptome. Molecular Neurobiology. 2021;58(2):603-616.  PubMed