Anti TH pAb (ATL-HPA061003 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA061003-25
- Shipping:
- Calculated at Checkout
$328.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Gene Name: TH
Alternative Gene Name: DYT5b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000214: 88%, ENSRNOG00000020410: 88%
Entrez Gene ID: 7054
Uniprot ID: P07101
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG |
Gene Sequence | SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG |
Gene ID - Mouse | ENSMUSG00000000214 |
Gene ID - Rat | ENSRNOG00000020410 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TH pAb (ATL-HPA061003 w/enhanced validation) | |
Datasheet | Anti TH pAb (ATL-HPA061003 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TH pAb (ATL-HPA061003 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti TH pAb (ATL-HPA061003 w/enhanced validation) | |
Datasheet | Anti TH pAb (ATL-HPA061003 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TH pAb (ATL-HPA061003 w/enhanced validation) |
Citations for Anti TH pAb (ATL-HPA061003 w/enhanced validation) – 2 Found |
Mastitskaya, Svetlana; Turovsky, Egor; Marina, Nephtali; Theparambil, Shefeeq M; Hadjihambi, Anna; Kasparov, Sergey; Teschemacher, Anja G; Ramage, Andrew G; Gourine, Alexander V; Hosford, Patrick S. Astrocytes Modulate Baroreflex Sensitivity at the Level of the Nucleus of the Solitary Tract. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2020;40(15):3052-3062. PubMed |
Yang, Weiwei; Hao, Wenwen; Meng, Zhuo; Ding, Shiyan; Li, Xiaodi; Zhang, Tao; Huang, Weixiao; Xu, Lian; Zhang, Yu; Yang, Jian; Gu, Xiaosong. Molecular Regulatory Mechanism and Toxicology of Neurodegenerative Processes in MPTP/Probenecid-Induced Progressive Parkinson's Disease Mice Model Revealed by Transcriptome. Molecular Neurobiology. 2021;58(2):603-616. PubMed |