Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029518-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: TGM2
Alternative Gene Name: TGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037820: 75%, ENSRNOG00000012956: 79%
Entrez Gene ID: 7052
Uniprot ID: P21980
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLP |
Gene Sequence | VEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLP |
Gene ID - Mouse | ENSMUSG00000037820 |
Gene ID - Rat | ENSRNOG00000012956 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) | |
Datasheet | Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) | |
Datasheet | Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) |
Citations for Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) – 2 Found |
Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
Hidaka, Hiedo; Seki, Naohiko; Yoshino, Hirofumi; Yamasaki, Takeshi; Yamada, Yasutoshi; Nohata, Nijiro; Fuse, Miki; Nakagawa, Masayuki; Enokida, Hideki. Tumor suppressive microRNA-1285 regulates novel molecular targets: aberrant expression and functional significance in renal cell carcinoma. Oncotarget. 2012;3(1):44-57. PubMed |