Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029518-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: TGM2
Alternative Gene Name: TGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037820: 75%, ENSRNOG00000012956: 79%
Entrez Gene ID: 7052
Uniprot ID: P21980
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLP |
| Gene Sequence | VEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLP |
| Gene ID - Mouse | ENSMUSG00000037820 |
| Gene ID - Rat | ENSRNOG00000012956 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) | |
| Datasheet | Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) | |
| Datasheet | Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) |
| Citations for Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) – 2 Found |
| Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
| Hidaka, Hiedo; Seki, Naohiko; Yoshino, Hirofumi; Yamasaki, Takeshi; Yamada, Yasutoshi; Nohata, Nijiro; Fuse, Miki; Nakagawa, Masayuki; Enokida, Hideki. Tumor suppressive microRNA-1285 regulates novel molecular targets: aberrant expression and functional significance in renal cell carcinoma. Oncotarget. 2012;3(1):44-57. PubMed |