Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA029518-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: transglutaminase 2
Gene Name: TGM2
Alternative Gene Name: TGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037820: 75%, ENSRNOG00000012956: 79%
Entrez Gene ID: 7052
Uniprot ID: P21980
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLP
Gene Sequence VEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLP
Gene ID - Mouse ENSMUSG00000037820
Gene ID - Rat ENSRNOG00000012956
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation)
Datasheet Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation)
Datasheet Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation)
Citations for Anti TGM2 pAb (ATL-HPA029518 w/enhanced validation) – 2 Found
Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300.  PubMed
Hidaka, Hiedo; Seki, Naohiko; Yoshino, Hirofumi; Yamasaki, Takeshi; Yamada, Yasutoshi; Nohata, Nijiro; Fuse, Miki; Nakagawa, Masayuki; Enokida, Hideki. Tumor suppressive microRNA-1285 regulates novel molecular targets: aberrant expression and functional significance in renal cell carcinoma. Oncotarget. 2012;3(1):44-57.  PubMed