Anti TGIF2 pAb (ATL-HPA053786)

Atlas Antibodies

Catalog No.:
ATL-HPA053786-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TGFB-induced factor homeobox 2
Gene Name: TGIF2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062175: 91%, ENSRNOG00000030925: 91%
Entrez Gene ID: 60436
Uniprot ID: Q9GZN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLF
Gene Sequence SVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLF
Gene ID - Mouse ENSMUSG00000062175
Gene ID - Rat ENSRNOG00000030925
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TGIF2 pAb (ATL-HPA053786)
Datasheet Anti TGIF2 pAb (ATL-HPA053786) Datasheet (External Link)
Vendor Page Anti TGIF2 pAb (ATL-HPA053786) at Atlas Antibodies

Documents & Links for Anti TGIF2 pAb (ATL-HPA053786)
Datasheet Anti TGIF2 pAb (ATL-HPA053786) Datasheet (External Link)
Vendor Page Anti TGIF2 pAb (ATL-HPA053786)