Anti TGFBR3L pAb (ATL-HPA074356)

Atlas Antibodies

Catalog No.:
ATL-HPA074356-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transforming growth factor, beta receptor III-like
Gene Name: TGFBR3L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000089736: 47%, ENSRNOG00000050573: 51%
Entrez Gene ID: 100507588
Uniprot ID: H3BV60
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FPGGLKGSARFLSFGPPFPAPPAPPFPAAPGPWLRRPLFSLKLSDTEDVFP
Gene Sequence FPGGLKGSARFLSFGPPFPAPPAPPFPAAPGPWLRRPLFSLKLSDTEDVFP
Gene ID - Mouse ENSMUSG00000089736
Gene ID - Rat ENSRNOG00000050573
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TGFBR3L pAb (ATL-HPA074356)
Datasheet Anti TGFBR3L pAb (ATL-HPA074356) Datasheet (External Link)
Vendor Page Anti TGFBR3L pAb (ATL-HPA074356) at Atlas Antibodies

Documents & Links for Anti TGFBR3L pAb (ATL-HPA074356)
Datasheet Anti TGFBR3L pAb (ATL-HPA074356) Datasheet (External Link)
Vendor Page Anti TGFBR3L pAb (ATL-HPA074356)
Citations for Anti TGFBR3L pAb (ATL-HPA074356) – 1 Found
Sjöstedt, Evelina; Kolnes, Anders J; Olarescu, Nicoleta C; Mitsios, Nicholas; Hikmet, Feria; Sivertsson, Åsa; Lindskog, Cecilia; Øystese, Kristin A B; Jørgensen, Anders P; Bollerslev, Jens; Casar-Borota, Olivera. TGFBR3L-An Uncharacterised Pituitary Specific Membrane Protein Detected in the Gonadotroph Cells in Non-Neoplastic and Tumour Tissue. Cancers. 2020;13(1)  PubMed