Anti TGFBR3L pAb (ATL-HPA074356)
Atlas Antibodies
- SKU:
- ATL-HPA074356-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TGFBR3L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000089736: 47%, ENSRNOG00000050573: 51%
Entrez Gene ID: 100507588
Uniprot ID: H3BV60
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FPGGLKGSARFLSFGPPFPAPPAPPFPAAPGPWLRRPLFSLKLSDTEDVFP |
Gene Sequence | FPGGLKGSARFLSFGPPFPAPPAPPFPAAPGPWLRRPLFSLKLSDTEDVFP |
Gene ID - Mouse | ENSMUSG00000089736 |
Gene ID - Rat | ENSRNOG00000050573 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TGFBR3L pAb (ATL-HPA074356) | |
Datasheet | Anti TGFBR3L pAb (ATL-HPA074356) Datasheet (External Link) |
Vendor Page | Anti TGFBR3L pAb (ATL-HPA074356) at Atlas Antibodies |
Documents & Links for Anti TGFBR3L pAb (ATL-HPA074356) | |
Datasheet | Anti TGFBR3L pAb (ATL-HPA074356) Datasheet (External Link) |
Vendor Page | Anti TGFBR3L pAb (ATL-HPA074356) |
Citations for Anti TGFBR3L pAb (ATL-HPA074356) – 1 Found |
Sjöstedt, Evelina; Kolnes, Anders J; Olarescu, Nicoleta C; Mitsios, Nicholas; Hikmet, Feria; Sivertsson, Åsa; Lindskog, Cecilia; Øystese, Kristin A B; Jørgensen, Anders P; Bollerslev, Jens; Casar-Borota, Olivera. TGFBR3L-An Uncharacterised Pituitary Specific Membrane Protein Detected in the Gonadotroph Cells in Non-Neoplastic and Tumour Tissue. Cancers. 2020;13(1) PubMed |