Anti TGFB3 pAb (ATL-HPA063582)

Atlas Antibodies

SKU:
ATL-HPA063582-25
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: transforming growth factor, beta 3
Gene Name: TGFB3
Alternative Gene Name: ARVD, ARVD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021253: 95%, ENSRNOG00000009867: 95%
Entrez Gene ID: 7043
Uniprot ID: P10600
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQ
Gene Sequence HGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQ
Gene ID - Mouse ENSMUSG00000021253
Gene ID - Rat ENSRNOG00000009867
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TGFB3 pAb (ATL-HPA063582)
Datasheet Anti TGFB3 pAb (ATL-HPA063582) Datasheet (External Link)
Vendor Page Anti TGFB3 pAb (ATL-HPA063582) at Atlas Antibodies

Documents & Links for Anti TGFB3 pAb (ATL-HPA063582)
Datasheet Anti TGFB3 pAb (ATL-HPA063582) Datasheet (External Link)
Vendor Page Anti TGFB3 pAb (ATL-HPA063582)