Anti TFPT pAb (ATL-HPA058534)

Atlas Antibodies

Catalog No.:
ATL-HPA058534-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: TCF3 (E2A) fusion partner (in childhood Leukemia)
Gene Name: TFPT
Alternative Gene Name: amida, FB1, INO80F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006335: 85%, ENSRNOG00000056098: 87%
Entrez Gene ID: 29844
Uniprot ID: P0C1Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSGRKRRRVPRDGRRAGNALTPELAPVQIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTL
Gene Sequence PSGRKRRRVPRDGRRAGNALTPELAPVQIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTL
Gene ID - Mouse ENSMUSG00000006335
Gene ID - Rat ENSRNOG00000056098
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TFPT pAb (ATL-HPA058534)
Datasheet Anti TFPT pAb (ATL-HPA058534) Datasheet (External Link)
Vendor Page Anti TFPT pAb (ATL-HPA058534) at Atlas Antibodies

Documents & Links for Anti TFPT pAb (ATL-HPA058534)
Datasheet Anti TFPT pAb (ATL-HPA058534) Datasheet (External Link)
Vendor Page Anti TFPT pAb (ATL-HPA058534)