Anti TFPT pAb (ATL-HPA058534)

Atlas Antibodies

Catalog No.: ATL-HPA058534-25

Protein Description: TCF3 (E2A) fusion partner (in childhood Leukemia)
Gene Name: TFPT
Alternative Gene Name: amida, FB1, INO80F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006335: 85%, ENSRNOG00000056098: 87%
Entrez Gene ID: 29844
Uniprot ID: P0C1Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSGRKRRRVPRDGRRAGNALTPELAPVQIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTL
• Gene Sequence: PSGRKRRRVPRDGRRAGNALTPELAPVQIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTL
• Gene ID - Mouse: ENSMUSG00000006335
• Gene ID - Rat: ENSRNOG00000056098
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.