Anti TFPT pAb (ATL-HPA058534)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058534-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TFPT
Alternative Gene Name: amida, FB1, INO80F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006335: 85%, ENSRNOG00000056098: 87%
Entrez Gene ID: 29844
Uniprot ID: P0C1Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSGRKRRRVPRDGRRAGNALTPELAPVQIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTL |
| Gene Sequence | PSGRKRRRVPRDGRRAGNALTPELAPVQIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTL |
| Gene ID - Mouse | ENSMUSG00000006335 |
| Gene ID - Rat | ENSRNOG00000056098 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TFPT pAb (ATL-HPA058534) | |
| Datasheet | Anti TFPT pAb (ATL-HPA058534) Datasheet (External Link) |
| Vendor Page | Anti TFPT pAb (ATL-HPA058534) at Atlas Antibodies |
| Documents & Links for Anti TFPT pAb (ATL-HPA058534) | |
| Datasheet | Anti TFPT pAb (ATL-HPA058534) Datasheet (External Link) |
| Vendor Page | Anti TFPT pAb (ATL-HPA058534) |