Anti TFPT pAb (ATL-HPA058534)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058534-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TFPT
Alternative Gene Name: amida, FB1, INO80F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006335: 85%, ENSRNOG00000056098: 87%
Entrez Gene ID: 29844
Uniprot ID: P0C1Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSGRKRRRVPRDGRRAGNALTPELAPVQIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTL |
Gene Sequence | PSGRKRRRVPRDGRRAGNALTPELAPVQIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTL |
Gene ID - Mouse | ENSMUSG00000006335 |
Gene ID - Rat | ENSRNOG00000056098 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TFPT pAb (ATL-HPA058534) | |
Datasheet | Anti TFPT pAb (ATL-HPA058534) Datasheet (External Link) |
Vendor Page | Anti TFPT pAb (ATL-HPA058534) at Atlas Antibodies |
Documents & Links for Anti TFPT pAb (ATL-HPA058534) | |
Datasheet | Anti TFPT pAb (ATL-HPA058534) Datasheet (External Link) |
Vendor Page | Anti TFPT pAb (ATL-HPA058534) |