Anti TFG pAb (ATL-HPA052206)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052206-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TFG
Alternative Gene Name: FLJ36137, SPG57, TF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022757: 96%, ENSRNOG00000001633: 97%
Entrez Gene ID: 10342
Uniprot ID: Q92734
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPS |
| Gene Sequence | LRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPS |
| Gene ID - Mouse | ENSMUSG00000022757 |
| Gene ID - Rat | ENSRNOG00000001633 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TFG pAb (ATL-HPA052206) | |
| Datasheet | Anti TFG pAb (ATL-HPA052206) Datasheet (External Link) |
| Vendor Page | Anti TFG pAb (ATL-HPA052206) at Atlas Antibodies |
| Documents & Links for Anti TFG pAb (ATL-HPA052206) | |
| Datasheet | Anti TFG pAb (ATL-HPA052206) Datasheet (External Link) |
| Vendor Page | Anti TFG pAb (ATL-HPA052206) |