Anti TFG pAb (ATL-HPA052206)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052206-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TFG
Alternative Gene Name: FLJ36137, SPG57, TF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022757: 96%, ENSRNOG00000001633: 97%
Entrez Gene ID: 10342
Uniprot ID: Q92734
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPS |
Gene Sequence | LRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPS |
Gene ID - Mouse | ENSMUSG00000022757 |
Gene ID - Rat | ENSRNOG00000001633 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TFG pAb (ATL-HPA052206) | |
Datasheet | Anti TFG pAb (ATL-HPA052206) Datasheet (External Link) |
Vendor Page | Anti TFG pAb (ATL-HPA052206) at Atlas Antibodies |
Documents & Links for Anti TFG pAb (ATL-HPA052206) | |
Datasheet | Anti TFG pAb (ATL-HPA052206) Datasheet (External Link) |
Vendor Page | Anti TFG pAb (ATL-HPA052206) |