Anti TFG pAb (ATL-HPA052206)

Atlas Antibodies

Catalog No.: ATL-HPA052206-25

Protein Description: TRK-fused gene
Gene Name: TFG
Alternative Gene Name: FLJ36137, SPG57, TF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022757: 96%, ENSRNOG00000001633: 97%
Entrez Gene ID: 10342
Uniprot ID: Q92734
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPS
• Gene Sequence: LRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPS
• Gene ID - Mouse: ENSMUSG00000022757
• Gene ID - Rat: ENSRNOG00000001633
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.