Anti TFEC pAb (ATL-HPA063577)

Atlas Antibodies

Catalog No.:
ATL-HPA063577-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transcription factor EC
Gene Name: TFEC
Alternative Gene Name: bHLHe34, TCFEC, TFECL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029553: 90%, ENSRNOG00000061595: 90%
Entrez Gene ID: 22797
Uniprot ID: O14948
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AIAFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAV
Gene Sequence AIAFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAV
Gene ID - Mouse ENSMUSG00000029553
Gene ID - Rat ENSRNOG00000061595
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TFEC pAb (ATL-HPA063577)
Datasheet Anti TFEC pAb (ATL-HPA063577) Datasheet (External Link)
Vendor Page Anti TFEC pAb (ATL-HPA063577) at Atlas Antibodies

Documents & Links for Anti TFEC pAb (ATL-HPA063577)
Datasheet Anti TFEC pAb (ATL-HPA063577) Datasheet (External Link)
Vendor Page Anti TFEC pAb (ATL-HPA063577)