Anti TFEC pAb (ATL-HPA063577)

Atlas Antibodies

SKU: ATL-HPA063577-25

• 

Protein Description: transcription factor EC
Gene Name: TFEC
Alternative Gene Name: bHLHe34, TCFEC, TFECL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029553: 90%, ENSRNOG00000061595: 90%
Entrez Gene ID: 22797
Uniprot ID: O14948
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AIAFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAV
• Gene Sequence: AIAFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAV
• Gene ID - Mouse: ENSMUSG00000029553
• Gene ID - Rat: ENSRNOG00000061595
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.