Anti-TFEB pAb (ATL-HPA067082)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067082-100
- Shipping:
- Calculated at Checkout
$554.00
| Product Specifications | |
| Application | ICC, WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASPGVRAGHVLSSSAGNSAPN |
| Gene Sequence | YHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASPGVRAGHVLSSSAGNSAPN |
| Gene ID - Mouse | ENSMUSG00000023990 |
| Gene ID - Rat | ENSRNOG00000014666 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti-TFEB pAb (ATL-HPA067082) | |
| Vendor Page | Anti-TFEB pAb (ATL-HPA067082) at Atlas Antibodies |
| Documents & Links for Anti-TFEB pAb (ATL-HPA067082) | |
| Vendor Page | Anti-TFEB pAb (ATL-HPA067082) |