Anti TFB2M pAb (ATL-HPA028554)

Atlas Antibodies

Catalog No.: ATL-HPA028554-25

Protein Description: transcription factor B2, mitochondrial
Gene Name: TFB2M
Alternative Gene Name: FLJ22661, FLJ23182, Hkp1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026492: 54%, ENSRNOG00000002695: 54%
Entrez Gene ID: 64216
Uniprot ID: Q9H5Q4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLED
• Gene Sequence: HLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLED
• Gene ID - Mouse: ENSMUSG00000026492
• Gene ID - Rat: ENSRNOG00000002695
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.