Anti TFB2M pAb (ATL-HPA028482)

Atlas Antibodies

Catalog No.:
ATL-HPA028482-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transcription factor B2, mitochondrial
Gene Name: TFB2M
Alternative Gene Name: FLJ22661, FLJ23182, Hkp1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026492: 34%, ENSRNOG00000002695: 36%
Entrez Gene ID: 64216
Uniprot ID: Q9H5Q4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GRFCILGSEAATRKHLPARNHCGLSDSSPQLWPEPDFRNPPRKASKASLDFKRYVTDRRLAETL
Gene Sequence GRFCILGSEAATRKHLPARNHCGLSDSSPQLWPEPDFRNPPRKASKASLDFKRYVTDRRLAETL
Gene ID - Mouse ENSMUSG00000026492
Gene ID - Rat ENSRNOG00000002695
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TFB2M pAb (ATL-HPA028482)
Datasheet Anti TFB2M pAb (ATL-HPA028482) Datasheet (External Link)
Vendor Page Anti TFB2M pAb (ATL-HPA028482) at Atlas Antibodies

Documents & Links for Anti TFB2M pAb (ATL-HPA028482)
Datasheet Anti TFB2M pAb (ATL-HPA028482) Datasheet (External Link)
Vendor Page Anti TFB2M pAb (ATL-HPA028482)