Anti TFB1M pAb (ATL-HPA029428 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029428-25

Protein Description: transcription factor B1, mitochondrial
Gene Name: TFB1M
Alternative Gene Name: CGI-75, mtTFB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036983: 87%, ENSRNOG00000056223: 89%
Entrez Gene ID: 51106
Uniprot ID: Q8WVM0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QRSRLSVMAQYLCNVRHIFTIPGQAFVPKPEVDVGVVHFTPLIQPKIEQPFKLVEKVVQNVFQFRRKYCHRGLRMLFPEAQRLESTGRLLELADIDPTLRPRQLSISHFKSLCDVYRKMCDEDPQL
• Gene Sequence: QRSRLSVMAQYLCNVRHIFTIPGQAFVPKPEVDVGVVHFTPLIQPKIEQPFKLVEKVVQNVFQFRRKYCHRGLRMLFPEAQRLESTGRLLELADIDPTLRPRQLSISHFKSLCDVYRKMCDEDPQL
• Gene ID - Mouse: ENSMUSG00000036983
• Gene ID - Rat: ENSRNOG00000056223
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TFB1M pAb (ATL-HPA029428 w/enhanced validation) – 1 Found

Yang, Wuping; Zhang, Kenan; Li, Lei; Xu, Yawei; Ma, Kaifang; Xie, Haibiao; Zhou, Jingcheng; Cai, Lin; Gong, Yanqing; Gong, Kan. Downregulation of lncRNA ZNF582-AS1 due to DNA hypermethylation promotes clear cell renal cell carcinoma growth and metastasis by regulating the N(6)-methyladenosine modification of MT-RNR1. Journal Of Experimental & Clinical Cancer Research : Cr. 2021;40(1):92.