Anti TFAP4 pAb (ATL-HPA001912 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001912-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TFAP4
Alternative Gene Name: AP-4, bHLHc41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005718: 100%, ENSRNOG00000005227: 100%
Entrez Gene ID: 7023
Uniprot ID: Q01664
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC, ChIP |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEK |
| Gene Sequence | YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEK |
| Gene ID - Mouse | ENSMUSG00000005718 |
| Gene ID - Rat | ENSRNOG00000005227 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TFAP4 pAb (ATL-HPA001912 w/enhanced validation) | |
| Datasheet | Anti TFAP4 pAb (ATL-HPA001912 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TFAP4 pAb (ATL-HPA001912 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TFAP4 pAb (ATL-HPA001912 w/enhanced validation) | |
| Datasheet | Anti TFAP4 pAb (ATL-HPA001912 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TFAP4 pAb (ATL-HPA001912 w/enhanced validation) |
| Citations for Anti TFAP4 pAb (ATL-HPA001912 w/enhanced validation) – 5 Found |
| Xue, Chengyuan; Yu, Denise M T; Gherardi, Samuele; Koach, Jessica; Milazzo, Giorgio; Gamble, Laura; Liu, Bing; Valli, Emanuele; Russell, Amanda J; London, Wendy B; Liu, Tao; Cheung, Belamy B; Marshall, Glenn M; Perini, Giovanni; Haber, Michelle; Norris, Murray D. MYCN promotes neuroblastoma malignancy by establishing a regulatory circuit with transcription factor AP4. Oncotarget. 2016;7(34):54937-54951. PubMed |
| Savio, Andrea J; Bapat, Bharati. Modulation of transcription factor binding and epigenetic regulation of the MLH1 CpG island and shore by polymorphism rs1800734 in colorectal cancer. Epigenetics. 2017;12(6):441-448. PubMed |
| Wang, Weiwei; Wu, Jianjun; Dai, Xulei; Cheng, Kun. Inhibitory effect of CC chemokine ligand 23 (CCL23)/ transcription factor activating enhancer binding protein 4 (TFAP4) on cell proliferation, invasion and angiogenesis in hepatocellular carcinoma. Bioengineered. 2022;13(1):1626-1636. PubMed |
| Jackstadt, Rene; Röh, Simone; Neumann, Jens; Jung, Peter; Hoffmann, Reinhard; Horst, David; Berens, Christian; Bornkamm, Georg W; Kirchner, Thomas; Menssen, Antje; Hermeking, Heiko. AP4 is a mediator of epithelial-mesenchymal transition and metastasis in colorectal cancer. The Journal Of Experimental Medicine. 2013;210(7):1331-50. PubMed |
| Cramer, Megan L; Xu, Rui; Martin, Paul T. Soluble Heparin Binding Epidermal Growth Factor-Like Growth Factor Is a Regulator of GALGT2 Expression and GALGT2-Dependent Muscle and Neuromuscular Phenotypes. Molecular And Cellular Biology. 2019;39(14) PubMed |