Anti TFAP2C pAb (ATL-HPA057076)

Atlas Antibodies

Catalog No.:
ATL-HPA057076-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)
Gene Name: TFAP2C
Alternative Gene Name: AP2-GAMMA, ERF1, hAP-2g, TFAP2G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028640: 92%, ENSRNOG00000005246: 92%
Entrez Gene ID: 7022
Uniprot ID: Q92754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK
Gene Sequence NYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK
Gene ID - Mouse ENSMUSG00000028640
Gene ID - Rat ENSRNOG00000005246
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TFAP2C pAb (ATL-HPA057076)
Datasheet Anti TFAP2C pAb (ATL-HPA057076) Datasheet (External Link)
Vendor Page Anti TFAP2C pAb (ATL-HPA057076) at Atlas Antibodies

Documents & Links for Anti TFAP2C pAb (ATL-HPA057076)
Datasheet Anti TFAP2C pAb (ATL-HPA057076) Datasheet (External Link)
Vendor Page Anti TFAP2C pAb (ATL-HPA057076)