Anti TFAP2C pAb (ATL-HPA057076)

Atlas Antibodies

SKU: ATL-HPA057076-25

• 

Protein Description: transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)
Gene Name: TFAP2C
Alternative Gene Name: AP2-GAMMA, ERF1, hAP-2g, TFAP2G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028640: 92%, ENSRNOG00000005246: 92%
Entrez Gene ID: 7022
Uniprot ID: Q92754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK
• Gene Sequence: NYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK
• Gene ID - Mouse: ENSMUSG00000028640
• Gene ID - Rat: ENSRNOG00000005246
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.