Anti TFAP2C pAb (ATL-HPA057076)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057076-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TFAP2C
Alternative Gene Name: AP2-GAMMA, ERF1, hAP-2g, TFAP2G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028640: 92%, ENSRNOG00000005246: 92%
Entrez Gene ID: 7022
Uniprot ID: Q92754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK |
| Gene Sequence | NYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK |
| Gene ID - Mouse | ENSMUSG00000028640 |
| Gene ID - Rat | ENSRNOG00000005246 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TFAP2C pAb (ATL-HPA057076) | |
| Datasheet | Anti TFAP2C pAb (ATL-HPA057076) Datasheet (External Link) |
| Vendor Page | Anti TFAP2C pAb (ATL-HPA057076) at Atlas Antibodies |
| Documents & Links for Anti TFAP2C pAb (ATL-HPA057076) | |
| Datasheet | Anti TFAP2C pAb (ATL-HPA057076) Datasheet (External Link) |
| Vendor Page | Anti TFAP2C pAb (ATL-HPA057076) |