Anti TFAM pAb (ATL-HPA040648 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA040648-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: transcription factor A, mitochondrial
Gene Name: TFAM
Alternative Gene Name: TCF6, TCF6L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003923: 60%, ENSRNOG00000000613: 62%
Entrez Gene ID: 7019
Uniprot ID: Q00059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKK
Gene Sequence AELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKK
Gene ID - Mouse ENSMUSG00000003923
Gene ID - Rat ENSRNOG00000000613
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TFAM pAb (ATL-HPA040648 w/enhanced validation)
Datasheet Anti TFAM pAb (ATL-HPA040648 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TFAM pAb (ATL-HPA040648 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TFAM pAb (ATL-HPA040648 w/enhanced validation)
Datasheet Anti TFAM pAb (ATL-HPA040648 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TFAM pAb (ATL-HPA040648 w/enhanced validation)
Citations for Anti TFAM pAb (ATL-HPA040648 w/enhanced validation) – 4 Found
Carrascoso, Isabel; Velasco, Beatriz Ramos; Izquierdo, José M. Deficiency of T-Cell Intracellular Antigen 1 in Murine Embryonic Fibroblasts Is Associated with Changes in Mitochondrial Morphology and Respiration. International Journal Of Molecular Sciences. 2021;22(23)  PubMed
Sotgia, Federica; Whitaker-Menezes, Diana; Martinez-Outschoorn, Ubaldo E; Salem, Ahmed F; Tsirigos, Aristotelis; Lamb, Rebecca; Sneddon, Sharon; Hulit, James; Howell, Anthony; Lisanti, Michael P. Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle (Georgetown, Tex.). 2012;11(23):4390-401.  PubMed
Qin, Jinshan; Guo, Yuting; Xue, Boxin; Shi, Peng; Chen, Yang; Su, Qian Peter; Hao, Huiwen; Zhao, Shujuan; Wu, Congying; Yu, Li; Li, Dong; Sun, Yujie. ER-mitochondria contacts promote mtDNA nucleoids active transportation via mitochondrial dynamic tubulation. Nature Communications. 2020;11(1):4471.  PubMed
Bajzikova, Martina; Kovarova, Jaromira; Coelho, Ana R; Boukalova, Stepana; Oh, Sehyun; Rohlenova, Katerina; Svec, David; Hubackova, Sona; Endaya, Berwini; Judasova, Kristyna; Bezawork-Geleta, Ayenachew; Kluckova, Katarina; Chatre, Laurent; Zobalova, Renata; Novakova, Anna; Vanova, Katerina; Ezrova, Zuzana; Maghzal, Ghassan J; Magalhaes Novais, Silvia; Olsinova, Marie; Krobova, Linda; An, Yong Jin; Davidova, Eliska; Nahacka, Zuzana; Sobol, Margarita; Cunha-Oliveira, Teresa; Sandoval-Acuña, Cristian; Strnad, Hynek; Zhang, Tongchuan; Huynh, Thanh; Serafim, Teresa L; Hozak, Pavel; Sardao, Vilma A; Koopman, Werner J H; Ricchetti, Miria; Oliveira, Paulo J; Kolar, Frantisek; Kubista, Mikael; Truksa, Jaroslav; Dvorakova-Hortova, Katerina; Pacak, Karel; Gurlich, Robert; Stocker, Roland; Zhou, Yaoqi; Berridge, Michael V; Park, Sunghyouk; Dong, Lanfeng; Rohlena, Jakub; Neuzil, Jiri. Reactivation of Dihydroorotate Dehydrogenase-Driven Pyrimidine Biosynthesis Restores Tumor Growth of Respiration-Deficient Cancer Cells. Cell Metabolism. 2019;29(2):399-416.e10.  PubMed