Anti TEX44 pAb (ATL-HPA049917 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA049917-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: testis expressed 44
Gene Name: TEX44
Alternative Gene Name: C2orf57, MGC35154
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021366: 28%, ENSRNOG00000030247: 28%
Entrez Gene ID: 165100
Uniprot ID: Q53QW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGNVDDSRSKDSPAGEPQGQVPLTADVLAVSSSVASTDWQDIDQASFKTATPRAISTSGDKDKSAVVPEHGQKTPRKITPLLPSQNPSPLQVS
Gene Sequence LGNVDDSRSKDSPAGEPQGQVPLTADVLAVSSSVASTDWQDIDQASFKTATPRAISTSGDKDKSAVVPEHGQKTPRKITPLLPSQNPSPLQVS
Gene ID - Mouse ENSMUSG00000021366
Gene ID - Rat ENSRNOG00000030247
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TEX44 pAb (ATL-HPA049917 w/enhanced validation)
Datasheet Anti TEX44 pAb (ATL-HPA049917 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TEX44 pAb (ATL-HPA049917 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TEX44 pAb (ATL-HPA049917 w/enhanced validation)
Datasheet Anti TEX44 pAb (ATL-HPA049917 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TEX44 pAb (ATL-HPA049917 w/enhanced validation)
Citations for Anti TEX44 pAb (ATL-HPA049917 w/enhanced validation) – 1 Found
Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.  PubMed