Anti TEX40 pAb (ATL-HPA052822)

Atlas Antibodies

Catalog No.:
ATL-HPA052822-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: testis expressed 40
Gene Name: TEX40
Alternative Gene Name: C11orf20, DKFZP566E164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050623: 70%, ENSRNOG00000051621: 70%
Entrez Gene ID: 25858
Uniprot ID: Q9NTU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN
Gene Sequence HRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN
Gene ID - Mouse ENSMUSG00000050623
Gene ID - Rat ENSRNOG00000051621
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TEX40 pAb (ATL-HPA052822)
Datasheet Anti TEX40 pAb (ATL-HPA052822) Datasheet (External Link)
Vendor Page Anti TEX40 pAb (ATL-HPA052822) at Atlas Antibodies

Documents & Links for Anti TEX40 pAb (ATL-HPA052822)
Datasheet Anti TEX40 pAb (ATL-HPA052822) Datasheet (External Link)
Vendor Page Anti TEX40 pAb (ATL-HPA052822)