Anti TEX261 pAb (ATL-HPA016631)

Atlas Antibodies

Catalog No.:
ATL-HPA016631-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: testis expressed 261
Gene Name: TEX261
Alternative Gene Name: MGC32043, TEG-261
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014748: 100%, ENSRNOG00000013712: 100%
Entrez Gene ID: 113419
Uniprot ID: Q6UWH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen NVLPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSFIKEAILPSRQKIY
Gene Sequence NVLPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSFIKEAILPSRQKIY
Gene ID - Mouse ENSMUSG00000014748
Gene ID - Rat ENSRNOG00000013712
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TEX261 pAb (ATL-HPA016631)
Datasheet Anti TEX261 pAb (ATL-HPA016631) Datasheet (External Link)
Vendor Page Anti TEX261 pAb (ATL-HPA016631) at Atlas Antibodies

Documents & Links for Anti TEX261 pAb (ATL-HPA016631)
Datasheet Anti TEX261 pAb (ATL-HPA016631) Datasheet (External Link)
Vendor Page Anti TEX261 pAb (ATL-HPA016631)
Citations for Anti TEX261 pAb (ATL-HPA016631) – 1 Found
Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094.  PubMed