Anti TEX261 pAb (ATL-HPA016631)

Atlas Antibodies

Catalog No.: ATL-HPA016631-100

Protein Description: testis expressed 261
Gene Name: TEX261
Alternative Gene Name: MGC32043, TEG-261
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014748: 100%, ENSRNOG00000013712: 100%
Entrez Gene ID: 113419
Uniprot ID: Q6UWH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVLPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSFIKEAILPSRQKIY
• Gene Sequence: NVLPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSFIKEAILPSRQKIY
• Gene ID - Mouse: ENSMUSG00000014748
• Gene ID - Rat: ENSRNOG00000013712
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TEX261 pAb (ATL-HPA016631) – 1 Found

Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094.