Anti TEX26 pAb (ATL-HPA079709)

Atlas Antibodies

Catalog No.:
ATL-HPA079709-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: testis expressed 26
Gene Name: TEX26
Alternative Gene Name: C13orf26, MGC40178
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029660: 66%, ENSRNOG00000000905: 71%
Entrez Gene ID: 122046
Uniprot ID: Q8N6G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLCHHNLQPTDDPNWDSYATTMRTAFTPKTGAVPALIRQNGIRRLGYTYSLSDPILNQTQYSDEYTWKSHSKE
Gene Sequence SLCHHNLQPTDDPNWDSYATTMRTAFTPKTGAVPALIRQNGIRRLGYTYSLSDPILNQTQYSDEYTWKSHSKE
Gene ID - Mouse ENSMUSG00000029660
Gene ID - Rat ENSRNOG00000000905
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TEX26 pAb (ATL-HPA079709)
Datasheet Anti TEX26 pAb (ATL-HPA079709) Datasheet (External Link)
Vendor Page Anti TEX26 pAb (ATL-HPA079709) at Atlas Antibodies

Documents & Links for Anti TEX26 pAb (ATL-HPA079709)
Datasheet Anti TEX26 pAb (ATL-HPA079709) Datasheet (External Link)
Vendor Page Anti TEX26 pAb (ATL-HPA079709)