Anti TEX26 pAb (ATL-HPA079709)
Atlas Antibodies
- Catalog No.:
- ATL-HPA079709-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TEX26
Alternative Gene Name: C13orf26, MGC40178
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029660: 66%, ENSRNOG00000000905: 71%
Entrez Gene ID: 122046
Uniprot ID: Q8N6G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLCHHNLQPTDDPNWDSYATTMRTAFTPKTGAVPALIRQNGIRRLGYTYSLSDPILNQTQYSDEYTWKSHSKE |
| Gene Sequence | SLCHHNLQPTDDPNWDSYATTMRTAFTPKTGAVPALIRQNGIRRLGYTYSLSDPILNQTQYSDEYTWKSHSKE |
| Gene ID - Mouse | ENSMUSG00000029660 |
| Gene ID - Rat | ENSRNOG00000000905 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TEX26 pAb (ATL-HPA079709) | |
| Datasheet | Anti TEX26 pAb (ATL-HPA079709) Datasheet (External Link) |
| Vendor Page | Anti TEX26 pAb (ATL-HPA079709) at Atlas Antibodies |
| Documents & Links for Anti TEX26 pAb (ATL-HPA079709) | |
| Datasheet | Anti TEX26 pAb (ATL-HPA079709) Datasheet (External Link) |
| Vendor Page | Anti TEX26 pAb (ATL-HPA079709) |