Anti TERT pAb (ATL-HPA054641)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054641-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: TERT
Alternative Gene Name: EST2, hEST2, TCS1, TP2, TRT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021611: 49%, ENSRNOG00000025327: 57%
Entrez Gene ID: 7015
Uniprot ID: O14746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS |
Gene Sequence | GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS |
Gene ID - Mouse | ENSMUSG00000021611 |
Gene ID - Rat | ENSRNOG00000025327 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TERT pAb (ATL-HPA054641) | |
Datasheet | Anti TERT pAb (ATL-HPA054641) Datasheet (External Link) |
Vendor Page | Anti TERT pAb (ATL-HPA054641) at Atlas Antibodies |
Documents & Links for Anti TERT pAb (ATL-HPA054641) | |
Datasheet | Anti TERT pAb (ATL-HPA054641) Datasheet (External Link) |
Vendor Page | Anti TERT pAb (ATL-HPA054641) |
Citations for Anti TERT pAb (ATL-HPA054641) – 1 Found |
Ayiomamitis, Georgios D; Notas, George; Vasilakaki, Thivi; Tsavari, Aikaterini; Vederaki, Styliani; Theodosopoulos, Theodosis; Kouroumalis, Elias; Zaravinos, Apostolos. Understanding the Interplay between COX-2 and hTERT in Colorectal Cancer Using a Multi-Omics Analysis. Cancers. 2019;11(10) PubMed |