Anti TEPP pAb (ATL-HPA062092 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA062092-25

• 

Protein Description: testis, prostate and placenta expressed
Gene Name: TEPP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090206: 77%, ENSRNOG00000013465: 70%
Entrez Gene ID: 374739
Uniprot ID: Q6URK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DRDTVKACLPDEHCQSTTYCRKDEFDNAHFTLLGVPNKPLQCLDITATGQKLRNRYHEGKLAPIAPGINRVDW
• Gene Sequence: DRDTVKACLPDEHCQSTTYCRKDEFDNAHFTLLGVPNKPLQCLDITATGQKLRNRYHEGKLAPIAPGINRVDW
• Gene ID - Mouse: ENSMUSG00000090206
• Gene ID - Rat: ENSRNOG00000013465
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.