Anti TEAD4 pAb (ATL-HPA056896)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056896-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TEAD4
Alternative Gene Name: EFTR-2, RTEF-1, TCF13L1, TEF-3, TEFR-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030353: 89%, ENSRNOG00000005608: 86%
Entrez Gene ID: 7004
Uniprot ID: Q15561
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGP |
Gene Sequence | ISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGP |
Gene ID - Mouse | ENSMUSG00000030353 |
Gene ID - Rat | ENSRNOG00000005608 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TEAD4 pAb (ATL-HPA056896) | |
Datasheet | Anti TEAD4 pAb (ATL-HPA056896) Datasheet (External Link) |
Vendor Page | Anti TEAD4 pAb (ATL-HPA056896) at Atlas Antibodies |
Documents & Links for Anti TEAD4 pAb (ATL-HPA056896) | |
Datasheet | Anti TEAD4 pAb (ATL-HPA056896) Datasheet (External Link) |
Vendor Page | Anti TEAD4 pAb (ATL-HPA056896) |
Citations for Anti TEAD4 pAb (ATL-HPA056896) – 5 Found |
Horii, Mariko; Li, Yingchun; Wakeland, Anna K; Pizzo, Donald P; Nelson, Katharine K; Sabatini, Karen; Laurent, Louise Chang; Liu, Ying; Parast, Mana M. Human pluripotent stem cells as a model of trophoblast differentiation in both normal development and disease. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(27):E3882-91. PubMed |
Zhou, Y; Huang, T; Zhang, J; Wong, C C; Zhang, B; Dong, Y; Wu, F; Tong, J H M; Wu, W K K; Cheng, A S L; Yu, J; Kang, W; To, K F. TEAD1/4 exerts oncogenic role and is negatively regulated by miR-4269 in gastric tumorigenesis. Oncogene. 2017;36(47):6518-6530. PubMed |
Soncin, Francesca; Khater, Marwa; To, Cuong; Pizzo, Donald; Farah, Omar; Wakeland, Anna; Arul Nambi Rajan, Kanaga; Nelson, Katharine K; Chang, Ching-Wen; Moretto-Zita, Matteo; Natale, David R; Laurent, Louise C; Parast, Mana M. Comparative analysis of mouse and human placentae across gestation reveals species-specific regulators of placental development. Development (Cambridge, England). 2018;145(2) PubMed |
Zhang, Jie; Liu, Pin; Tao, Junyan; Wang, Pan; Zhang, Yi; Song, Xinhua; Che, Li; Sumazin, Pavel; Ribback, Silvia; Kiss, Andras; Schaff, Zsuzsa; Cigliano, Antonio; Dombrowski, Frank; Cossu, Carla; Pascale, Rosa M; Calvisi, Diego F; Monga, Satdarshan P; Chen, Xin. TEA Domain Transcription Factor 4 Is the Major Mediator of Yes-Associated Protein Oncogenic Activity in Mouse and Human Hepatoblastoma. The American Journal Of Pathology. 2019;189(5):1077-1090. PubMed |
Jaju Bhattad, Gargi; Jeyarajah, Mariyan J; McGill, Megan G; Dumeaux, Vanessa; Okae, Hiroaki; Arima, Takahiro; Lajoie, Patrick; Bérubé, Nathalie G; Renaud, Stephen J. Histone deacetylase 1 and 2 drive differentiation and fusion of progenitor cells in human placental trophoblasts. Cell Death & Disease. 2020;11(5):311. PubMed |