Anti TEAD2 pAb (ATL-HPA066292)

Atlas Antibodies

Catalog No.:
ATL-HPA066292-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: TEA domain family member 2
Gene Name: TEAD2
Alternative Gene Name: ETF, TEF-4, TEF4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030796: 94%, ENSRNOG00000020695: 96%
Entrez Gene ID: 8463
Uniprot ID: Q15562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDV
Gene Sequence TARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDV
Gene ID - Mouse ENSMUSG00000030796
Gene ID - Rat ENSRNOG00000020695
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TEAD2 pAb (ATL-HPA066292)
Datasheet Anti TEAD2 pAb (ATL-HPA066292) Datasheet (External Link)
Vendor Page Anti TEAD2 pAb (ATL-HPA066292) at Atlas Antibodies

Documents & Links for Anti TEAD2 pAb (ATL-HPA066292)
Datasheet Anti TEAD2 pAb (ATL-HPA066292) Datasheet (External Link)
Vendor Page Anti TEAD2 pAb (ATL-HPA066292)