Anti TEAD2 pAb (ATL-HPA066292)

Atlas Antibodies

Catalog No.: ATL-HPA066292-25

Protein Description: TEA domain family member 2
Gene Name: TEAD2
Alternative Gene Name: ETF, TEF-4, TEF4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030796: 94%, ENSRNOG00000020695: 96%
Entrez Gene ID: 8463
Uniprot ID: Q15562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDV
• Gene Sequence: TARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDV
• Gene ID - Mouse: ENSMUSG00000030796
• Gene ID - Rat: ENSRNOG00000020695
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.