Anti TEAD1 pAb (ATL-HPA057339)

Atlas Antibodies

Catalog No.: ATL-HPA057339-100

Protein Description: TEA domain family member 1 (SV40 transcriptional enhancer factor)
Gene Name: TEAD1
Alternative Gene Name: AA, TCF13, TEF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055320: 97%, ENSRNOG00000015488: 99%
Entrez Gene ID: 7003
Uniprot ID: P28347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASA
• Gene Sequence: VSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASA
• Gene ID - Mouse: ENSMUSG00000055320
• Gene ID - Rat: ENSRNOG00000015488
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.