Anti TEAD1 pAb (ATL-HPA057339)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057339-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: TEAD1
Alternative Gene Name: AA, TCF13, TEF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055320: 97%, ENSRNOG00000015488: 99%
Entrez Gene ID: 7003
Uniprot ID: P28347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASA |
Gene Sequence | VSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASA |
Gene ID - Mouse | ENSMUSG00000055320 |
Gene ID - Rat | ENSRNOG00000015488 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TEAD1 pAb (ATL-HPA057339) | |
Datasheet | Anti TEAD1 pAb (ATL-HPA057339) Datasheet (External Link) |
Vendor Page | Anti TEAD1 pAb (ATL-HPA057339) at Atlas Antibodies |
Documents & Links for Anti TEAD1 pAb (ATL-HPA057339) | |
Datasheet | Anti TEAD1 pAb (ATL-HPA057339) Datasheet (External Link) |
Vendor Page | Anti TEAD1 pAb (ATL-HPA057339) |