Anti TEAD1 pAb (ATL-HPA057339)

Atlas Antibodies

Catalog No.:
ATL-HPA057339-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: TEA domain family member 1 (SV40 transcriptional enhancer factor)
Gene Name: TEAD1
Alternative Gene Name: AA, TCF13, TEF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055320: 97%, ENSRNOG00000015488: 99%
Entrez Gene ID: 7003
Uniprot ID: P28347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASA
Gene Sequence VSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASA
Gene ID - Mouse ENSMUSG00000055320
Gene ID - Rat ENSRNOG00000015488
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TEAD1 pAb (ATL-HPA057339)
Datasheet Anti TEAD1 pAb (ATL-HPA057339) Datasheet (External Link)
Vendor Page Anti TEAD1 pAb (ATL-HPA057339) at Atlas Antibodies

Documents & Links for Anti TEAD1 pAb (ATL-HPA057339)
Datasheet Anti TEAD1 pAb (ATL-HPA057339) Datasheet (External Link)
Vendor Page Anti TEAD1 pAb (ATL-HPA057339)