Anti TDRD3 pAb (ATL-HPA067153)

Atlas Antibodies

Catalog No.:
ATL-HPA067153-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tudor domain containing 3
Gene Name: TDRD3
Alternative Gene Name: FLJ21007
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022019: 75%, ENSRNOG00000009034: 80%
Entrez Gene ID: 81550
Uniprot ID: Q9H7E2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRFQRDSQNSKSVLEGSGLPRNRGSERPSTSSVSEVWAEDRIKCDRPYSRYDRTKDTSYPLGSQHSDGAFKKRDNSMQSRSGKGP
Gene Sequence PRFQRDSQNSKSVLEGSGLPRNRGSERPSTSSVSEVWAEDRIKCDRPYSRYDRTKDTSYPLGSQHSDGAFKKRDNSMQSRSGKGP
Gene ID - Mouse ENSMUSG00000022019
Gene ID - Rat ENSRNOG00000009034
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TDRD3 pAb (ATL-HPA067153)
Datasheet Anti TDRD3 pAb (ATL-HPA067153) Datasheet (External Link)
Vendor Page Anti TDRD3 pAb (ATL-HPA067153) at Atlas Antibodies

Documents & Links for Anti TDRD3 pAb (ATL-HPA067153)
Datasheet Anti TDRD3 pAb (ATL-HPA067153) Datasheet (External Link)
Vendor Page Anti TDRD3 pAb (ATL-HPA067153)