Anti TDRD10 pAb (ATL-HPA054327)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054327-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TDRD10
Alternative Gene Name: DKFZp434M202
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026383: 26%, ENSRNOG00000000699: 24%
Entrez Gene ID: 126668
Uniprot ID: Q5VZ19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VMFIDFGQLATIPVQSLRSLDSDDFWTIPPLTQPFMLEKDILSSYEVVHRILKGKITGALNSAVTAPASNLAVVPPLL |
| Gene Sequence | VMFIDFGQLATIPVQSLRSLDSDDFWTIPPLTQPFMLEKDILSSYEVVHRILKGKITGALNSAVTAPASNLAVVPPLL |
| Gene ID - Mouse | ENSMUSG00000026383 |
| Gene ID - Rat | ENSRNOG00000000699 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TDRD10 pAb (ATL-HPA054327) | |
| Datasheet | Anti TDRD10 pAb (ATL-HPA054327) Datasheet (External Link) |
| Vendor Page | Anti TDRD10 pAb (ATL-HPA054327) at Atlas Antibodies |
| Documents & Links for Anti TDRD10 pAb (ATL-HPA054327) | |
| Datasheet | Anti TDRD10 pAb (ATL-HPA054327) Datasheet (External Link) |
| Vendor Page | Anti TDRD10 pAb (ATL-HPA054327) |