Anti TDRD10 pAb (ATL-HPA054327)

Atlas Antibodies

Catalog No.:
ATL-HPA054327-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tudor domain containing 10
Gene Name: TDRD10
Alternative Gene Name: DKFZp434M202
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026383: 26%, ENSRNOG00000000699: 24%
Entrez Gene ID: 126668
Uniprot ID: Q5VZ19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VMFIDFGQLATIPVQSLRSLDSDDFWTIPPLTQPFMLEKDILSSYEVVHRILKGKITGALNSAVTAPASNLAVVPPLL
Gene Sequence VMFIDFGQLATIPVQSLRSLDSDDFWTIPPLTQPFMLEKDILSSYEVVHRILKGKITGALNSAVTAPASNLAVVPPLL
Gene ID - Mouse ENSMUSG00000026383
Gene ID - Rat ENSRNOG00000000699
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TDRD10 pAb (ATL-HPA054327)
Datasheet Anti TDRD10 pAb (ATL-HPA054327) Datasheet (External Link)
Vendor Page Anti TDRD10 pAb (ATL-HPA054327) at Atlas Antibodies

Documents & Links for Anti TDRD10 pAb (ATL-HPA054327)
Datasheet Anti TDRD10 pAb (ATL-HPA054327) Datasheet (External Link)
Vendor Page Anti TDRD10 pAb (ATL-HPA054327)