Anti TDP2 pAb (ATL-HPA074011)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074011-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TDP2
Alternative Gene Name: TTRAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035958: 77%, ENSRNOG00000018246: 76%
Entrez Gene ID: 51567
Uniprot ID: O95551
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIP |
Gene Sequence | MQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIP |
Gene ID - Mouse | ENSMUSG00000035958 |
Gene ID - Rat | ENSRNOG00000018246 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TDP2 pAb (ATL-HPA074011) | |
Datasheet | Anti TDP2 pAb (ATL-HPA074011) Datasheet (External Link) |
Vendor Page | Anti TDP2 pAb (ATL-HPA074011) at Atlas Antibodies |
Documents & Links for Anti TDP2 pAb (ATL-HPA074011) | |
Datasheet | Anti TDP2 pAb (ATL-HPA074011) Datasheet (External Link) |
Vendor Page | Anti TDP2 pAb (ATL-HPA074011) |