Anti TDP2 pAb (ATL-HPA074011)

Atlas Antibodies

Catalog No.:
ATL-HPA074011-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tyrosyl-DNA phosphodiesterase 2
Gene Name: TDP2
Alternative Gene Name: TTRAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035958: 77%, ENSRNOG00000018246: 76%
Entrez Gene ID: 51567
Uniprot ID: O95551
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIP
Gene Sequence MQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIP
Gene ID - Mouse ENSMUSG00000035958
Gene ID - Rat ENSRNOG00000018246
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TDP2 pAb (ATL-HPA074011)
Datasheet Anti TDP2 pAb (ATL-HPA074011) Datasheet (External Link)
Vendor Page Anti TDP2 pAb (ATL-HPA074011) at Atlas Antibodies

Documents & Links for Anti TDP2 pAb (ATL-HPA074011)
Datasheet Anti TDP2 pAb (ATL-HPA074011) Datasheet (External Link)
Vendor Page Anti TDP2 pAb (ATL-HPA074011)