Anti TCTEX1D2 pAb (ATL-HPA049555)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049555-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TCTEX1D2
Alternative Gene Name: MGC33212
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014075: 90%, ENSRNOG00000001758: 90%
Entrez Gene ID: 255758
Uniprot ID: Q8WW35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDAD |
Gene Sequence | PQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDAD |
Gene ID - Mouse | ENSMUSG00000014075 |
Gene ID - Rat | ENSRNOG00000001758 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TCTEX1D2 pAb (ATL-HPA049555) | |
Datasheet | Anti TCTEX1D2 pAb (ATL-HPA049555) Datasheet (External Link) |
Vendor Page | Anti TCTEX1D2 pAb (ATL-HPA049555) at Atlas Antibodies |
Documents & Links for Anti TCTEX1D2 pAb (ATL-HPA049555) | |
Datasheet | Anti TCTEX1D2 pAb (ATL-HPA049555) Datasheet (External Link) |
Vendor Page | Anti TCTEX1D2 pAb (ATL-HPA049555) |