Anti TCTEX1D2 pAb (ATL-HPA049555)

Atlas Antibodies

Catalog No.:
ATL-HPA049555-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Tctex1 domain containing 2
Gene Name: TCTEX1D2
Alternative Gene Name: MGC33212
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014075: 90%, ENSRNOG00000001758: 90%
Entrez Gene ID: 255758
Uniprot ID: Q8WW35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDAD
Gene Sequence PQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDAD
Gene ID - Mouse ENSMUSG00000014075
Gene ID - Rat ENSRNOG00000001758
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCTEX1D2 pAb (ATL-HPA049555)
Datasheet Anti TCTEX1D2 pAb (ATL-HPA049555) Datasheet (External Link)
Vendor Page Anti TCTEX1D2 pAb (ATL-HPA049555) at Atlas Antibodies

Documents & Links for Anti TCTEX1D2 pAb (ATL-HPA049555)
Datasheet Anti TCTEX1D2 pAb (ATL-HPA049555) Datasheet (External Link)
Vendor Page Anti TCTEX1D2 pAb (ATL-HPA049555)