Anti TCTA pAb (ATL-HPA007342)

Atlas Antibodies

Catalog No.:
ATL-HPA007342-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: T-cell leukemia translocation altered
Gene Name: TCTA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039461: 81%, ENSRNOG00000048237: 84%
Entrez Gene ID: 6988
Uniprot ID: P57738
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKL
Gene Sequence AESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKL
Gene ID - Mouse ENSMUSG00000039461
Gene ID - Rat ENSRNOG00000048237
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCTA pAb (ATL-HPA007342)
Datasheet Anti TCTA pAb (ATL-HPA007342) Datasheet (External Link)
Vendor Page Anti TCTA pAb (ATL-HPA007342) at Atlas Antibodies

Documents & Links for Anti TCTA pAb (ATL-HPA007342)
Datasheet Anti TCTA pAb (ATL-HPA007342) Datasheet (External Link)
Vendor Page Anti TCTA pAb (ATL-HPA007342)