Anti TCP11L2 pAb (ATL-HPA042188)

Atlas Antibodies

Catalog No.:
ATL-HPA042188-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: t-complex 11, testis-specific-like 2
Gene Name: TCP11L2
Alternative Gene Name: MGC40368
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020034: 79%, ENSRNOG00000007587: 80%
Entrez Gene ID: 255394
Uniprot ID: Q8N4U5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLIDKRIKLYMRRLLCLPSPQKCMPPMPGGLAVIQQELEALGSQYANIVNLNKQVYGPFYANILRKLLFNEEAMGKVDASPPTN
Gene Sequence SLIDKRIKLYMRRLLCLPSPQKCMPPMPGGLAVIQQELEALGSQYANIVNLNKQVYGPFYANILRKLLFNEEAMGKVDASPPTN
Gene ID - Mouse ENSMUSG00000020034
Gene ID - Rat ENSRNOG00000007587
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCP11L2 pAb (ATL-HPA042188)
Datasheet Anti TCP11L2 pAb (ATL-HPA042188) Datasheet (External Link)
Vendor Page Anti TCP11L2 pAb (ATL-HPA042188) at Atlas Antibodies

Documents & Links for Anti TCP11L2 pAb (ATL-HPA042188)
Datasheet Anti TCP11L2 pAb (ATL-HPA042188) Datasheet (External Link)
Vendor Page Anti TCP11L2 pAb (ATL-HPA042188)