Anti TCP11 pAb (ATL-HPA048311)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048311-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TCP11
Alternative Gene Name: D6S230E, FPPR, KIAA0229
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058252: 78%, ENSRNOG00000011034: 81%
Entrez Gene ID: 6954
Uniprot ID: Q8WWU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LILIEKELAELGWKFLNLMHHNQQVFGPYYAEILKH |
Gene Sequence | LILIEKELAELGWKFLNLMHHNQQVFGPYYAEILKH |
Gene ID - Mouse | ENSMUSG00000058252 |
Gene ID - Rat | ENSRNOG00000011034 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TCP11 pAb (ATL-HPA048311) | |
Datasheet | Anti TCP11 pAb (ATL-HPA048311) Datasheet (External Link) |
Vendor Page | Anti TCP11 pAb (ATL-HPA048311) at Atlas Antibodies |
Documents & Links for Anti TCP11 pAb (ATL-HPA048311) | |
Datasheet | Anti TCP11 pAb (ATL-HPA048311) Datasheet (External Link) |
Vendor Page | Anti TCP11 pAb (ATL-HPA048311) |