Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053163-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TCL1B
Alternative Gene Name: TML1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079007: 32%, ENSRNOG00000025233: 27%
Entrez Gene ID: 9623
Uniprot ID: O95988
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPE |
| Gene Sequence | WQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPE |
| Gene ID - Mouse | ENSMUSG00000079007 |
| Gene ID - Rat | ENSRNOG00000025233 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation) | |
| Datasheet | Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation) | |
| Datasheet | Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation) |