Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA053163-25

Protein Description: T-cell leukemia/lymphoma 1B
Gene Name: TCL1B
Alternative Gene Name: TML1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079007: 32%, ENSRNOG00000025233: 27%
Entrez Gene ID: 9623
Uniprot ID: O95988
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPE
• Gene Sequence: WQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPE
• Gene ID - Mouse: ENSMUSG00000079007
• Gene ID - Rat: ENSRNOG00000025233
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.