Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA053163-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: T-cell leukemia/lymphoma 1B
Gene Name: TCL1B
Alternative Gene Name: TML1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079007: 32%, ENSRNOG00000025233: 27%
Entrez Gene ID: 9623
Uniprot ID: O95988
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPE
Gene Sequence WQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPE
Gene ID - Mouse ENSMUSG00000079007
Gene ID - Rat ENSRNOG00000025233
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation)
Datasheet Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation)
Datasheet Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TCL1B pAb (ATL-HPA053163 w/enhanced validation)