Anti TCHHL1 pAb (ATL-HPA063483 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA063483-25
  • Immunohistochemical staining of human cerebral cortex, kidney, lymph node and skin, hairy using Anti-TCHHL1 antibody HPA063483 (A) shows similar protein distribution across tissues to independent antibody HPA042579 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: trichohyalin-like 1
Gene Name: TCHHL1
Alternative Gene Name: S100A17, THHL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063163: 25%, ENSRNOG00000030714: 25%
Entrez Gene ID: 126637
Uniprot ID: Q5QJ38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDQEPCSVERGAVYSSPLYQYLQEKILQQTNVTQEEHQKQVQIAQASGPELCSVSLTSEISDCSVFFNYSQASQPYTRGLPLDESPAGAQETPAPQ
Gene Sequence RDQEPCSVERGAVYSSPLYQYLQEKILQQTNVTQEEHQKQVQIAQASGPELCSVSLTSEISDCSVFFNYSQASQPYTRGLPLDESPAGAQETPAPQ
Gene ID - Mouse ENSMUSG00000063163
Gene ID - Rat ENSRNOG00000030714
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti TCHHL1 pAb (ATL-HPA063483 w/enhanced validation)
Datasheet Anti TCHHL1 pAb (ATL-HPA063483 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TCHHL1 pAb (ATL-HPA063483 w/enhanced validation)