Anti TCHH pAb (ATL-HPA028375)

Atlas Antibodies

Catalog No.:
ATL-HPA028375-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: trichohyalin
Gene Name: TCHH
Alternative Gene Name: THH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052415: 63%, ENSRNOG00000056746: 63%
Entrez Gene ID: 7062
Uniprot ID: Q07283
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQFASVPVRSSPLYEY
Gene Sequence QEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQFASVPVRSSPLYEY
Gene ID - Mouse ENSMUSG00000052415
Gene ID - Rat ENSRNOG00000056746
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCHH pAb (ATL-HPA028375)
Datasheet Anti TCHH pAb (ATL-HPA028375) Datasheet (External Link)
Vendor Page Anti TCHH pAb (ATL-HPA028375) at Atlas Antibodies

Documents & Links for Anti TCHH pAb (ATL-HPA028375)
Datasheet Anti TCHH pAb (ATL-HPA028375) Datasheet (External Link)
Vendor Page Anti TCHH pAb (ATL-HPA028375)