Anti TCF7L1 pAb (ATL-HPA071298)

Atlas Antibodies

SKU:
ATL-HPA071298-25
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transcription factor 7-like 1 (T-cell specific, HMG-box)
Gene Name: TCF7L1
Alternative Gene Name: TCF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055799: 96%, ENSRNOG00000014753: 99%
Entrez Gene ID: 83439
Uniprot ID: Q9HCS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKP
Gene Sequence ALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKP
Gene ID - Mouse ENSMUSG00000055799
Gene ID - Rat ENSRNOG00000014753
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TCF7L1 pAb (ATL-HPA071298)
Datasheet Anti TCF7L1 pAb (ATL-HPA071298) Datasheet (External Link)
Vendor Page Anti TCF7L1 pAb (ATL-HPA071298) at Atlas Antibodies

Documents & Links for Anti TCF7L1 pAb (ATL-HPA071298)
Datasheet Anti TCF7L1 pAb (ATL-HPA071298) Datasheet (External Link)
Vendor Page Anti TCF7L1 pAb (ATL-HPA071298)