Anti TCF7 pAb (ATL-HPA070505)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070505-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TCF7
Alternative Gene Name: TCF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000782: 69%, ENSRNOG00000005872: 69%
Entrez Gene ID: 6932
Uniprot ID: P36402
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAK |
Gene Sequence | KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAK |
Gene ID - Mouse | ENSMUSG00000000782 |
Gene ID - Rat | ENSRNOG00000005872 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TCF7 pAb (ATL-HPA070505) | |
Datasheet | Anti TCF7 pAb (ATL-HPA070505) Datasheet (External Link) |
Vendor Page | Anti TCF7 pAb (ATL-HPA070505) at Atlas Antibodies |
Documents & Links for Anti TCF7 pAb (ATL-HPA070505) | |
Datasheet | Anti TCF7 pAb (ATL-HPA070505) Datasheet (External Link) |
Vendor Page | Anti TCF7 pAb (ATL-HPA070505) |