Anti TCF7 pAb (ATL-HPA070505)

Atlas Antibodies

SKU: ATL-HPA070505-25

• 
• 

Protein Description: transcription factor 7 (T-cell specific, HMG-box)
Gene Name: TCF7
Alternative Gene Name: TCF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000782: 69%, ENSRNOG00000005872: 69%
Entrez Gene ID: 6932
Uniprot ID: P36402
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAK
• Gene Sequence: KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAK
• Gene ID - Mouse: ENSMUSG00000000782
• Gene ID - Rat: ENSRNOG00000005872
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.