Anti TCF7 pAb (ATL-HPA058863)

Atlas Antibodies

Catalog No.:
ATL-HPA058863-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: transcription factor 7 (T-cell specific, HMG-box)
Gene Name: TCF7
Alternative Gene Name: TCF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024985: 38%, ENSRNOG00000049232: 38%
Entrez Gene ID: 6932
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KKCIRYLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYHLLPRFPTELLTSPAE
Gene Sequence KKCIRYLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYHLLPRFPTELLTSPAE
Gene ID - Mouse ENSMUSG00000024985
Gene ID - Rat ENSRNOG00000049232
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCF7 pAb (ATL-HPA058863)
Datasheet Anti TCF7 pAb (ATL-HPA058863) Datasheet (External Link)
Vendor Page Anti TCF7 pAb (ATL-HPA058863) at Atlas Antibodies

Documents & Links for Anti TCF7 pAb (ATL-HPA058863)
Datasheet Anti TCF7 pAb (ATL-HPA058863) Datasheet (External Link)
Vendor Page Anti TCF7 pAb (ATL-HPA058863)