Anti TCF4 pAb (ATL-HPA025958)

Atlas Antibodies

Catalog No.: ATL-HPA025958-25

Protein Description: transcription factor 4
Gene Name: TCF4
Alternative Gene Name: bHLHb19, E2-2, ITF2, SEF2-1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053477: 96%, ENSRNOG00000012405: 98%
Entrez Gene ID: 6925
Uniprot ID: P15884
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQD
• Gene Sequence: HGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQD
• Gene ID - Mouse: ENSMUSG00000053477
• Gene ID - Rat: ENSRNOG00000012405
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TCF4 pAb (ATL-HPA025958) – 1 Found

Saegusa, Makoto; Hashimura, Miki; Kuwata, Takeshi. Sox4 functions as a positive regulator of β-catenin signaling through upregulation of TCF4 during morular differentiation of endometrial carcinomas. Laboratory Investigation; A Journal Of Technical Methods And Pathology. 2012;92(4):511-21.