Anti TCF3 pAb (ATL-HPA049808)

Atlas Antibodies

Catalog No.:
ATL-HPA049808-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: transcription factor 3
Gene Name: TCF3
Alternative Gene Name: bHLHb21, E2A, E47, ITF1, MGC129647, MGC129648, VDIR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020167: 74%, ENSRNOG00000051499: 71%
Entrez Gene ID: 6929
Uniprot ID: P15923
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS
Gene Sequence RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS
Gene ID - Mouse ENSMUSG00000020167
Gene ID - Rat ENSRNOG00000051499
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCF3 pAb (ATL-HPA049808)
Datasheet Anti TCF3 pAb (ATL-HPA049808) Datasheet (External Link)
Vendor Page Anti TCF3 pAb (ATL-HPA049808) at Atlas Antibodies

Documents & Links for Anti TCF3 pAb (ATL-HPA049808)
Datasheet Anti TCF3 pAb (ATL-HPA049808) Datasheet (External Link)
Vendor Page Anti TCF3 pAb (ATL-HPA049808)