Anti TCF3 pAb (ATL-HPA049808)

Atlas Antibodies

Catalog No.: ATL-HPA049808-25

Protein Description: transcription factor 3
Gene Name: TCF3
Alternative Gene Name: bHLHb21, E2A, E47, ITF1, MGC129647, MGC129648, VDIR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020167: 74%, ENSRNOG00000051499: 71%
Entrez Gene ID: 6929
Uniprot ID: P15923
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS
• Gene Sequence: RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS
• Gene ID - Mouse: ENSMUSG00000020167
• Gene ID - Rat: ENSRNOG00000051499
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.