Anti TCERG1 pAb (ATL-HPA069752)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069752-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TCERG1
Alternative Gene Name: CA150, TAF2S, Urn1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024498: 96%, ENSRNOG00000018849: 96%
Entrez Gene ID: 10915
Uniprot ID: O14776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLE |
| Gene Sequence | HPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLE |
| Gene ID - Mouse | ENSMUSG00000024498 |
| Gene ID - Rat | ENSRNOG00000018849 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TCERG1 pAb (ATL-HPA069752) | |
| Datasheet | Anti TCERG1 pAb (ATL-HPA069752) Datasheet (External Link) |
| Vendor Page | Anti TCERG1 pAb (ATL-HPA069752) at Atlas Antibodies |
| Documents & Links for Anti TCERG1 pAb (ATL-HPA069752) | |
| Datasheet | Anti TCERG1 pAb (ATL-HPA069752) Datasheet (External Link) |
| Vendor Page | Anti TCERG1 pAb (ATL-HPA069752) |