Anti TCEANC2 pAb (ATL-HPA046918)

Atlas Antibodies

Catalog No.:
ATL-HPA046918-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transcription elongation factor A (SII) N-terminal and central domain containing 2
Gene Name: TCEANC2
Alternative Gene Name: C1orf83, FLJ32112
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028619: 86%, ENSRNOG00000009398: 82%
Entrez Gene ID: 127428
Uniprot ID: Q96MN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TMLELPDQTKENLVEALQELKKKIPSREVLKSTRIGHTVNKMRKHSDSEVASLAREVYTEWKTFTEKHSNRPSIEV
Gene Sequence TMLELPDQTKENLVEALQELKKKIPSREVLKSTRIGHTVNKMRKHSDSEVASLAREVYTEWKTFTEKHSNRPSIEV
Gene ID - Mouse ENSMUSG00000028619
Gene ID - Rat ENSRNOG00000009398
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCEANC2 pAb (ATL-HPA046918)
Datasheet Anti TCEANC2 pAb (ATL-HPA046918) Datasheet (External Link)
Vendor Page Anti TCEANC2 pAb (ATL-HPA046918) at Atlas Antibodies

Documents & Links for Anti TCEANC2 pAb (ATL-HPA046918)
Datasheet Anti TCEANC2 pAb (ATL-HPA046918) Datasheet (External Link)
Vendor Page Anti TCEANC2 pAb (ATL-HPA046918)