Anti TCEANC2 pAb (ATL-HPA046918)

Atlas Antibodies

Catalog No.: ATL-HPA046918-25

Protein Description: transcription elongation factor A (SII) N-terminal and central domain containing 2
Gene Name: TCEANC2
Alternative Gene Name: C1orf83, FLJ32112
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028619: 86%, ENSRNOG00000009398: 82%
Entrez Gene ID: 127428
Uniprot ID: Q96MN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TMLELPDQTKENLVEALQELKKKIPSREVLKSTRIGHTVNKMRKHSDSEVASLAREVYTEWKTFTEKHSNRPSIEV
• Gene Sequence: TMLELPDQTKENLVEALQELKKKIPSREVLKSTRIGHTVNKMRKHSDSEVASLAREVYTEWKTFTEKHSNRPSIEV
• Gene ID - Mouse: ENSMUSG00000028619
• Gene ID - Rat: ENSRNOG00000009398
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.