Anti TCEANC pAb (ATL-HPA001013 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001013-25

Protein Description: transcription elongation factor A (SII) N-terminal and central domain containing
Gene Name: TCEANC
Alternative Gene Name: MGC17403
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051224: 52%, ENSRNOG00000004531: 53%
Entrez Gene ID: 170082
Uniprot ID: Q8N8B7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETDVVRAVYRVLKNCPSVALKKKAKCLLSKWKAVYKQTHSKARNSPKLFPVRGNKEENSGPSHDPSQNETLGICSSNSLSSQDVAKLSEMIVPENRAIQLKPKEEHFGDGDPESTGK
• Gene Sequence: ETDVVRAVYRVLKNCPSVALKKKAKCLLSKWKAVYKQTHSKARNSPKLFPVRGNKEENSGPSHDPSQNETLGICSSNSLSSQDVAKLSEMIVPENRAIQLKPKEEHFGDGDPESTGK
• Gene ID - Mouse: ENSMUSG00000051224
• Gene ID - Rat: ENSRNOG00000004531
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.