Anti TCEAL9 pAb (ATL-HPA011790 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA011790-25

Protein Description: transcription elongation factor A like 9
Gene Name: TCEAL9
Alternative Gene Name: DKFZp313K1940, WBP5, WEX6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042712: 71%, ENSRNOG00000034198: 79%
Entrez Gene ID: 51186
Uniprot ID: Q9UHQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRN
• Gene Sequence: EGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRN
• Gene ID - Mouse: ENSMUSG00000042712
• Gene ID - Rat: ENSRNOG00000034198
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TCEAL9 pAb (ATL-HPA011790 w/enhanced validation) – 1 Found

Qian, Yangyang; Pan, Zongfu; Guo, Zhenying; Ge, Xinyang; Zheng, Guowan; Cao, Jun; Huang, Ping; Zhu, Xin; Zhu, Xuhang; Wen, Qingliang; Ge, Minghua. Clinicopathological and Prognostic Significance of WW Domain Binding Protein 5 Expression in Papillary Thyroid Carcinoma. Biomed Research International. 2019( 31828091):1791065.