Anti TCEAL8 pAb (ATL-HPA059115)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059115-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TCEAL8
Alternative Gene Name: MGC45400, WEX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051579: 71%, ENSRNOG00000028585: 71%
Entrez Gene ID: 90843
Uniprot ID: Q8IYN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFR |
Gene Sequence | PQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFR |
Gene ID - Mouse | ENSMUSG00000051579 |
Gene ID - Rat | ENSRNOG00000028585 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TCEAL8 pAb (ATL-HPA059115) | |
Datasheet | Anti TCEAL8 pAb (ATL-HPA059115) Datasheet (External Link) |
Vendor Page | Anti TCEAL8 pAb (ATL-HPA059115) at Atlas Antibodies |
Documents & Links for Anti TCEAL8 pAb (ATL-HPA059115) | |
Datasheet | Anti TCEAL8 pAb (ATL-HPA059115) Datasheet (External Link) |
Vendor Page | Anti TCEAL8 pAb (ATL-HPA059115) |