Anti TCEAL8 pAb (ATL-HPA059115)

Atlas Antibodies

Catalog No.:
ATL-HPA059115-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transcription elongation factor A (SII)-like 8
Gene Name: TCEAL8
Alternative Gene Name: MGC45400, WEX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051579: 71%, ENSRNOG00000028585: 71%
Entrez Gene ID: 90843
Uniprot ID: Q8IYN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFR
Gene Sequence PQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFR
Gene ID - Mouse ENSMUSG00000051579
Gene ID - Rat ENSRNOG00000028585
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCEAL8 pAb (ATL-HPA059115)
Datasheet Anti TCEAL8 pAb (ATL-HPA059115) Datasheet (External Link)
Vendor Page Anti TCEAL8 pAb (ATL-HPA059115) at Atlas Antibodies

Documents & Links for Anti TCEAL8 pAb (ATL-HPA059115)
Datasheet Anti TCEAL8 pAb (ATL-HPA059115) Datasheet (External Link)
Vendor Page Anti TCEAL8 pAb (ATL-HPA059115)