Anti TCEAL8 pAb (ATL-HPA059115)

Atlas Antibodies

Catalog No.: ATL-HPA059115-25

Protein Description: transcription elongation factor A (SII)-like 8
Gene Name: TCEAL8
Alternative Gene Name: MGC45400, WEX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051579: 71%, ENSRNOG00000028585: 71%
Entrez Gene ID: 90843
Uniprot ID: Q8IYN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFR
• Gene Sequence: PQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFR
• Gene ID - Mouse: ENSMUSG00000051579
• Gene ID - Rat: ENSRNOG00000028585
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.