Anti TCEAL1 pAb (ATL-HPA060384)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060384-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TCEAL1
Alternative Gene Name: p21, pp21, SIIR, WEX9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049536: 61%, ENSRNOG00000002387: 57%
Entrez Gene ID: 9338
Uniprot ID: Q15170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSE |
Gene Sequence | MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSE |
Gene ID - Mouse | ENSMUSG00000049536 |
Gene ID - Rat | ENSRNOG00000002387 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TCEAL1 pAb (ATL-HPA060384) | |
Datasheet | Anti TCEAL1 pAb (ATL-HPA060384) Datasheet (External Link) |
Vendor Page | Anti TCEAL1 pAb (ATL-HPA060384) at Atlas Antibodies |
Documents & Links for Anti TCEAL1 pAb (ATL-HPA060384) | |
Datasheet | Anti TCEAL1 pAb (ATL-HPA060384) Datasheet (External Link) |
Vendor Page | Anti TCEAL1 pAb (ATL-HPA060384) |