Anti TCEAL1 pAb (ATL-HPA060384)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060384-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TCEAL1
Alternative Gene Name: p21, pp21, SIIR, WEX9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049536: 61%, ENSRNOG00000002387: 57%
Entrez Gene ID: 9338
Uniprot ID: Q15170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSE |
| Gene Sequence | MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSE |
| Gene ID - Mouse | ENSMUSG00000049536 |
| Gene ID - Rat | ENSRNOG00000002387 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TCEAL1 pAb (ATL-HPA060384) | |
| Datasheet | Anti TCEAL1 pAb (ATL-HPA060384) Datasheet (External Link) |
| Vendor Page | Anti TCEAL1 pAb (ATL-HPA060384) at Atlas Antibodies |
| Documents & Links for Anti TCEAL1 pAb (ATL-HPA060384) | |
| Datasheet | Anti TCEAL1 pAb (ATL-HPA060384) Datasheet (External Link) |
| Vendor Page | Anti TCEAL1 pAb (ATL-HPA060384) |