Anti TCEAL1 pAb (ATL-HPA060384)

Atlas Antibodies

Catalog No.:
ATL-HPA060384-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transcription elongation factor A like 1
Gene Name: TCEAL1
Alternative Gene Name: p21, pp21, SIIR, WEX9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049536: 61%, ENSRNOG00000002387: 57%
Entrez Gene ID: 9338
Uniprot ID: Q15170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSE
Gene Sequence MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSE
Gene ID - Mouse ENSMUSG00000049536
Gene ID - Rat ENSRNOG00000002387
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TCEAL1 pAb (ATL-HPA060384)
Datasheet Anti TCEAL1 pAb (ATL-HPA060384) Datasheet (External Link)
Vendor Page Anti TCEAL1 pAb (ATL-HPA060384) at Atlas Antibodies

Documents & Links for Anti TCEAL1 pAb (ATL-HPA060384)
Datasheet Anti TCEAL1 pAb (ATL-HPA060384) Datasheet (External Link)
Vendor Page Anti TCEAL1 pAb (ATL-HPA060384)