Anti TCEAL1 pAb (ATL-HPA060384)

Atlas Antibodies

Catalog No.: ATL-HPA060384-25

Protein Description: transcription elongation factor A like 1
Gene Name: TCEAL1
Alternative Gene Name: p21, pp21, SIIR, WEX9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049536: 61%, ENSRNOG00000002387: 57%
Entrez Gene ID: 9338
Uniprot ID: Q15170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSE
• Gene Sequence: MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSE
• Gene ID - Mouse: ENSMUSG00000049536
• Gene ID - Rat: ENSRNOG00000002387
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.