Anti TCAF1 pAb (ATL-HPA011732)

Atlas Antibodies

Catalog No.: ATL-HPA011732-25

Protein Description: TRPM8 channel-associated factor 1
Gene Name: TCAF1
Alternative Gene Name: FAM115A, KIAA0738
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036667: 95%, ENSRNOG00000017911: 96%
Entrez Gene ID: 9747
Uniprot ID: Q9Y4C2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFTVGKLGPFLLNAVRWLDGGRRGKIVVQTELRTLSGLLAVGGIDTSIEPNLTSDASVYCFEPVSEVGVKELQEFVAEGGGLFVGAQAWWWAFKNPGVSPLARFPGNL
• Gene Sequence: LFTVGKLGPFLLNAVRWLDGGRRGKIVVQTELRTLSGLLAVGGIDTSIEPNLTSDASVYCFEPVSEVGVKELQEFVAEGGGLFVGAQAWWWAFKNPGVSPLARFPGNL
• Gene ID - Mouse: ENSMUSG00000036667
• Gene ID - Rat: ENSRNOG00000017911
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.