Anti TBX6 pAb (ATL-HPA062498)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062498-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TBX6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030699: 94%, ENSRNOG00000019771: 94%
Entrez Gene ID: 6911
Uniprot ID: O95947
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFIS |
Gene Sequence | HKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFIS |
Gene ID - Mouse | ENSMUSG00000030699 |
Gene ID - Rat | ENSRNOG00000019771 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TBX6 pAb (ATL-HPA062498) | |
Datasheet | Anti TBX6 pAb (ATL-HPA062498) Datasheet (External Link) |
Vendor Page | Anti TBX6 pAb (ATL-HPA062498) at Atlas Antibodies |
Documents & Links for Anti TBX6 pAb (ATL-HPA062498) | |
Datasheet | Anti TBX6 pAb (ATL-HPA062498) Datasheet (External Link) |
Vendor Page | Anti TBX6 pAb (ATL-HPA062498) |